• Home /
  • N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Product Name: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Size: 1 mg
Catalogue Number: BA-CSB-RP213644Ba
Price:
$124.00
Description:

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

AA Sequence:

MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSHHHHHHHHHHLVPRGSRT+Target Protein Sequence+AAAEQKLISEEDL

Source:

E.coli

Tag Information:

Tag/control Protein

TOP