• Home /
  • N-terminal 6xHis-SUMO-tagged

N-terminal 6xHis-SUMO-tagged

Product Name: N-terminal 6xHis-SUMO-tagged
Size: 1 mg
Catalogue Number: BA-CSB-RP213344Ba (Cusabio Product, Promo Item)
Price:
$124.00
Description:

N-terminal 6xHis-SUMO-tagged

AA Sequence:

MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT

Tag Information:

Tag/control Protein

TOP