• Home /
  • Recombinant Human Acyl-CoA-binding protein

Recombinant Human Acyl-CoA-binding protein

Product Name: Recombinant Human Acyl-CoA-binding protein
Size: 1 mg
Catalogue Number: BA-CSB-EP006519HU - 1 mg (Cusabio product)
Price:
$1,139.00
AA Sequence:

MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Source:

E.coli

Uniprot ID:

P07108

Gene ID:

DBI

Biological Relevance:

Transport

Tag Information:

His-tag

Expression Region:

2-105aa

More Information:

MW = 15.9kD; Full length

TOP