• Home /
  • Recombinant Human Arylsulfatase B

Recombinant Human Arylsulfatase B

Product Name: Recombinant Human Arylsulfatase B
Size: 1 mg
Catalogue Number: BA-CSB-EP002142HU - 1 mg (Cusabio product)
Price:
$1,139.00
AA Sequence:

SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM

Source:

E.coli

Uniprot ID:

P15848

Gene ID:

ARSB

Biological Relevance:

Cancer

Tag Information:

His-SUMO-tag

Expression Region:

37-533aa

More Information:

MW = 72kD; Full length

TOP