• Home /
  • Recombinant Human Fatty acid-binding protein, liver

Recombinant Human Fatty acid-binding protein, liver

Product Name: Recombinant Human Fatty acid-binding protein, liver
Size: 1 mg
Catalogue Number: BA-CSB-EP007940HU - 1 mg (Cusabio product)
Price:
$1,139.00
AA Sequence:

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Source:

E.coli

Uniprot ID:

P07148

Gene ID:

FABP1

Biological Relevance:

Transport

Tag Information:

GST-tag

Expression Region:

1-127aa

More Information:

MW = 41.6kD; Full length

TOP