• Home /
  • Recombinant Rat Ephrin-A1

Recombinant Rat Ephrin-A1

Product Name: Recombinant Rat Ephrin-A1
Size: 1 mg
Catalogue Number: BA-CSB-EP007460RA - 1 mg (Cusabio product)
Price:
$1,139.00
AA Sequence:

ADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVTCEPQSKDQVRWKCNQPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIYHQETQCLKLKVTVNGKITHSPHAHANPQEKRLQADDPEVQVLHSIGHS

Source:

E.coli

Uniprot ID:

P97553

Gene ID:

Efna1

Tag Information:

His-tag

Expression Region:

18-182aa

More Information:

MW = 23.5kD; Full length

TOP