• Home /
  • Recombinant Toxoplasma gondii Inflammatory profilin protein

Recombinant Toxoplasma gondii Inflammatory profilin protein

Product Name: Recombinant Toxoplasma gondii Inflammatory profilin protein
Size: 1 mg
Catalogue Number: BA-CSB-RP151074Ba - 1 mg (Cusabio product)
Price:
$759.00
AA Sequence:

SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY

Source:

E.coli

Uniprot ID:

Q58NA1

Gene ID:

PRF TGVEG_014090

Tag Information:

His-tag

Expression Region:

2-163aa

More Information:

MW = 21.5kD; Full length

TOP